PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc04161.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 316aa    MW: 33360.7 Da    PI: 9.7916
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc04161.1.g00010.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof104.94.6e-331481461
                        zf-Dof 14 tntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                  ++tkfCy+nny++sqPr+fCk+C+ryWt+GGa+rnvPvG+grrknk++
  Zjn_sc04161.1.g00010.1.am.mk  1 MDTKFCYFNNYNVSQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKNKNA 48
                                  69*******************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.2E-26147IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-21146IPR003851Zinc finger, Dof-type
PROSITE profilePS5088424.456147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MDTKFCYFNN YNVSQPRHFC KNCQRYWTAG GAMRNVPVGA GRRKNKNAVA ASHFLQKVRA  60
AVPVGGDPLK TNGTVLSFGA HGAAPALDLA EQVVGHLKEK MLVPVGNAGN HQSVVDPCSD  120
VSSTRDAKNL SVNGVQHPAN MNGGATMWPY GCAPPSQAYY PSGIAIPIYP AAPGYWGCMV  180
PGGWSPLPWP LQPPTQGLSS PTSTAPSVSS GAGHSLTLGK HAREGDEGRS HGSGKVWAPK  240
TIRIGDADEV AKSSIWSLIG IKGDKQNTDT DGRKNGTVFE PKHEAKSAKQ AMITSSPLLH  300
ANPVALTRSL TFQEGS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5823991e-73KC582399.1 Sorghum bicolor dof2 protein (dof2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983151.11e-159PREDICTED: cyclic dof factor 1-like
TrEMBLK4AA811e-159K4AA81_SETIT; Uncharacterized protein
STRINGSi035787m1e-159(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-50cycling DOF factor 2